Ultralyd til vaccineproduktion

Ultralyd er en gennemprøvet metode til at ødelægge eller inaktivere vira, bakterier og gær. Derudover er sonikatorer pålidelige til lysering af celler, fx virale eller bakterielle celler og frigivelse af intracellulært stof, fx proteiner, DNA / RNA, enzymer og bioaktive stoffer. Derfor anvendes Hielscher-sonikatorer ofte som pålidelige celle- og virusbehandlingsteknikker under vaccinefremstilling. Derefter anvendes ultralydhomogenisering til at formulere solid-lipid nanobærere eller liposomer, mens ultralyddispersion og deagglomerering påføres på forskellige trin under vaccineproduktion for at opnå en homogen suspension.

Ultralyd Vaccine Produktion

Til fremstilling af vacciner, herunder inaktiverede, svækkede proteinunderenheder eller konjugatvacciner, skal celler enten inaktiveres, lyseres eller dræbes. Med den passende dosis og intensitet af sonikering kan celler og mikrober behandles i overensstemmelse med procesmål.

Påfør ultralydbølger til:

  • forstyrre og lysere celler
  • inaktivere virale og bakterielle celler
  • frigivelse af intracellulært materiale, fx proteiner, antigener
  • stimulere bakteriel aktivitet
  • forberede nanoteknologibærere
  • aktivere / inaktivere enzymer
  • Forbered nanoemulsioner og dobbeltemulsioner

Anmodning om oplysninger




Bemærk vores Fortrolighedspolitik.


Ultralyd homogenisator til vaccine fremstilling. Hielscher sonikatorer anvendes til cellelyse, til homogenisering af cellesuspensioner, til stimulering af cellevækst, til indkapsling, til adjuverende proteinbinding og antigendispersion.

Ultralyd vaccine produktionssystem: Sonikator UIP2000hdT med rustfrit stål reaktor

Flere anvendelser af sonikatorer i vaccineproduktion

I vaccineproduktion spiller Hielscher-sonikatorer en afgørende rolle i forskellige faser, herunder antigenproduktion, indkapsling, formulering og det væsentlige afgasningstrin inden påfyldning af vacciner i hætteglas eller sprøjter.
 
Antigen Dispersion:
For at opnå en stabil vaccineformulering er det afgørende, at antigener, såsom cellefragmenter eller proteinantigener, dispergeres ensartet i suspensioner, polymerer eller liposomale indkapslinger. Sonikering har været en gennemprøvet og langvarig teknik til fremstilling af farmaceutiske produkter, hvilket viser dets effektivitet til fremstilling af fine dispersioner, hvilket gør det til et etableret værktøj i moderne vaccineproduktion.
 
Adjuvanser:
Blanding og homogenisering af adjuvanser i vaccineformuleringer opnås pålideligt og effektivt ved sonikering. En almindelig type adjuvans, der anvendes i vaccineformuleringer, er aluminiumbaserede adjuvanser, der består af små primære partikler, der let kan aggregeres til en funktionel enhed. For vellykket integration med antigener er en ensartet fordeling af antigener gennem den aluminiumholdige vaccine nødvendig. Ultralyddispersion tjener dette formål ved at forberede homogene dispersioner af antigener og adjuvanser, såsom Alhydrogel™.
 
Inaktivering af patogen:
Desuden finder effekt ultralyd anvendelse i inaktivering af patogener som bakterier og vira. Når det kommer til at forberede en effektiv colibacillosevaccine, har ultralydsdeaktivering af E. coli efterfulgt af bestråling vist sig at være den mest potente teknik.
 
Mikrobiel inaktivering og stabilisering:
Sonicator UP200Ht med mikrospids (sonde) anvendes i farmaceutisk og vaccineproduktion for at forstyrre celler og indkapsle lægemidler i liposomale og nanostrukturerede formuleringerKonventionelt opnås mikrobiel inaktivering gennem termisk pasteurisering og sterilisering, som involverer langvarig udsættelse for høje temperaturer, hvilket ofte fører til termisk induceret forringelse af funktionelle egenskaber. Imidlertid giver kombinationen af sonikering og varme, kendt som termo-sonikering, en hurtigere steriliseringshastighed med signifikant reduceret termisk intensitet og varighed. Dette er især fordelagtigt til konservering af varmefølsomme forbindelser, såsom proteiner og antigener. Processen med ultralydsterilisering og pasteurisering er ikke kun omkostningseffektiv, men også energibesparende og miljøvenlig.
 
Liposomer og nanobærere:
Hielscher-sonikatorer bruges til at formulere lægemidler og vacciner i liposomer og nanostrukturerede lægemiddelbærere såsom solid-lipid nanopartikler. Sonikering er en effektiv og pålidelig teknik til at indkapsle aktive ingredienser i liposomer og nanopartikler. Under ultralydindkapsling er præcis kontrol over størrelsen af liposomer og nanobærere tilladt, hvilket fører til et mere konsistent og ensartet lægemiddelafgivelsessystem. Samtidig muliggør sonde-type sonikatorer forbedret lægemiddelbelastning: De mekaniske kræfter, der genereres under sonikering, hjælper med at forbedre lægemiddelindkapslingseffektiviteten, hvilket sikrer, at en højere mængde lægemiddel er inkorporeret i bærerne. Med ultralydindkapsling kommer også forbedret stabilitet, da sonikering fremmer dannelsen af stabile liposomer og nanocarriers, som er afgørende for deres vellykkede anvendelse i vaccinelevering.
 

Ultralydfremstilling af nanopartikler med fast lipid producerer nanostrukturerede lægemiddelbærere med høj biotilgængelighed, høj stabilitet og lav cytotoksicitet

Trin i ultralydproduktion af solid-lipid nanopartikler
(Kumar et al. 2019)

 

Find dybdegående information og videnskabelige undersøgelser om specifikke sonikerings-assited vaccine applikationer:

Ultralyd vaccine forberedelse på Lab og Industrial Scale

Hielscher Ultrasonics tilbyder en bred vifte af ultralydsenheder fra lab skala sonikatorer til fuld industriel kvalitet ultralyd homogenisatorer til kommerciel produktion. Vi dækker dine behov fra små ultralydapparater til din forskningsafdeling op til fuldstrømsbehandling af dine kommercielt producerede lægemidler.

Pålidelig og justerbar til dine applikationsbehov

Ved at justere parametrene for ultralydbehandling kan effekten af ​​sonikering styres nøjagtigt. Det betyder, at en lav amplitude og kort lydbehandling har meget bløde effekter, mens høje amplituder, forhøjet tryk og længere lydbehandling resulterer i intens behandling.
Hielscher leverer kraftfulde ultralydsenheder, der kan styres præcist i overensstemmelse med proceskravene. Manifold sonotroder og tilbehør afslutter tilbuddet.

Dette videoklip viser Hielscher ultralydshomogenisator UP100H, en ultralydsapparat, der i vid udstrækning anvendes til prøveforberedelse i laboratorier.

Ultralyd homogenisator UP100H

Videominiaturebillede

Sikker og ren

Hielscher ultralydapparater kan nemt installeres i renrum laboratorier og produktionsfaciliteter. Husene på vores enheder er lavet af antibakteriel plast eller rustfrit stål. Alle fugtede dele, såsom vores sonotroder og flowceller, er lavet af titanium eller rustfrit stål og kan autoklaveres.
Hielscher Ultrasonics tilbyder en manifold vifte af standard sonde-type sonikatorer og tilbehør samt tilpasset udstyr.

Fordele

  • nøjagtigt justerbar til processen
  • ren & hygiejnisk behandling
  • stærkt reproducerbare
  • lineær opdeling
  • Let & sikker drift
  • pålidelig & robust udstyr
  • høj effektivitet
  • Kontakt os! / Spørg Os!

    Bed om mere information

    Brug venligst nedenstående formular til at anmode om yderligere oplysninger om vores sonikatorer, vaccine- og life science-relaterede applikationer samt priser. Vi vil være glade for at diskutere din biokemiske proces med dig og tilbyde dig en ultralydhomogenisator, der opfylder dine krav!









    Bemærk venligst, at vores Fortrolighedspolitik.


     

    Videoen viser ultralydsprøveforberedelsessystemet UIP400MTP, som giver mulighed for pålidelig prøveforberedelse af alle standard multi-brøndplader ved hjælp af højintensiv ultralyd. Typiske anvendelser af UIP400MTP omfatter celle lysis, DNA, RNA, og kromatin klipning samt proteinudvinding.

    Ultralydsdronning UIP400MTP til multi-well plade sonikering

    Videominiaturebillede

     


    Litteratur / Referencer

    Industriel ultralydhomogenisator med flowcellereaktor

    MultiSonoReactor MSR-4 er en industriel inline reaktor til ultralydsproduktion af lægemidler og vacciner

    FIND DIN ANVENDELSE:
    Klargør væv
    Forstyrre celler
    Forbered lysater
    Ekstraher DNA / RNA
    Ekstrakter Proteiner
    Homogeniser suspenderinger
    Emulger liposomer
    stimulere bakteriel aktivitet
    Fremskynde enzymatiske reaktioner
    fremskynde kemiske reaktioner
    Forbered emulsioner
    Disperse pulvere
    Degas Væsker
    Deaglomeratpartikler
    Opløs pulver
    Opløs tabletter


    Fakta Værd at vide

    Ultralydvævshomogenisatorer henvises ofte til sonde sonicator / sonificator, sonic lyser, ultralyd disruptor, ultralydslibemaskine, sono-ruptor, sonifier, sonic dismembrator, celleforstyrrende, ultralyd dispergeringsmiddel, emulgator eller opløsningsmiddel. De forskellige vilkår er resultatet af de forskellige applikationer, der kan opfyldes af sonikering.

    Vi vil være glade for at diskutere din proces.

    Lad os komme i kontakt.